PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P01670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33171.2 Da    PI: 8.5061
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P01670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65e-19135189256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ +++k+q  +Lee F++n++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr1P01670_001 135 RKKLRLSKDQSAILEESFKENSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 189
                            788899***********************************************98 PP

2HD-ZIP_I/II126.21.5e-40135224191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+ +Lkr++++l+een+rL+kev+eLr
  GSMUA_Achr1P01670_001 135 RKKLRLSKDQSAILEESFKENSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCGFLKRCCENLTEENRRLQKEVQELR 222
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr1P01670_001 223 -AL 224
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.0E-243110IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.006131191IPR001356Homeobox domain
SuperFamilySSF466892.99E-18133192IPR009057Homeodomain-like
SMARTSM003891.1E-15133195IPR001356Homeobox domain
PfamPF000461.8E-16135189IPR001356Homeobox domain
CDDcd000861.84E-15135192No hitNo description
Gene3DG3DSA:1.10.10.607.0E-18140189IPR009057Homeodomain-like
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
PfamPF021831.3E-11191225IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-25191234IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MLTEKEDLAL SLSLSSSTNH FDHSSPSRPL PSSCVQKPRW SHLLFAPSED RPTLDVWRGA  60
GDAQPVLRMI DVNWASSAAA AAGRDSEEEA DASSPDSATS SVGGKRAERD KKHEAERPCS  120
RGAASDEEDG DLVSRKKLRL SKDQSAILEE SFKENSTLNP KQKLALAKQL NLRPRQVEVW  180
FQNRRARTKL KQTEVDCGFL KRCCENLTEE NRRLQKEVQE LRALKLSPHF YTQMTPPTTL  240
IMCPSCERAS KSSTATSSTN APLPEHHQFL PHHRQVSAPW APISLRPSFL DAPPQRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139SRKKLRL
2183191RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401762.10.0PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466012e-83HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLM0RW750.0M0RW75_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P01670_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-59homeobox protein 2